buy Sermorelin Acetate peptides online 100mg ( 50vials of 2mg each)
Sermorelin(GHRH) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland adjacent to the pituitary gland.GHRH is a peptide that contains the first 29 amino acids of our own GH.buy Sermorelin online.These 29 amino acids are the active amino acids of GHRH.(where to buy sermorelin? www.biopepshop.com). It is GHRH that stimulates the pituitary glands to release GH.As we get older,the hormones produced by the anterior pituitary are depleted. It has now been shown that GHRH can restore the GH-RNA to a youthful level causing elevation of levels of IGF-1.buy sermorelin acetate
Product Name:Sermorelin 2mg
Catalogue Number:L648976
Synonyms:Sermorelin Acetate
CAS NO.:86168-78-7
Molecular Formula:C149H246N44O42S
Molecular Weight:3357.88
Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
One Letter Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Source:Chemical Synthesis
2.How does Sermorelin come?
Sermorelin is presented in a multi-dosed,injectable vial. Each vial contains a powder disc which contains 2mg (2,000 micrograms) of lyophilized Sermorelin Acetate.buy Sermorelin online.The vial is vacuum sealed by the pharmacy for your protection and for the preservation of the hormone peptide. Each Sermorelin vial also comes with a bottle of Bacteriostatic Water as a diluent.buy sermorelin acetate,The Bacteriostatic Water is mixed with the Sermorelin to provide solution for injection. Administration and storage instructions will be provided with your prescription.(where to buy sermorelin? www.biopepshop.com).
3.How do I take Sermorelin?
Sermorelin is injected into the body fat,subcutaneously,using a very small needle similar to what a diabetic uses to inject insulin.buy sermorelin acetate.Injections are initially prescribed for every day and are decreased in frequency over time.buy Sermorelin online.(where to buy sermorelin?).
4.When do I take Sermorelin?
The best time to take Sermorelin is prior to bedtime..(where to buy sermorelin?).Growth Hormone is primarily released during sleep and most beneficial to the body’s recovery and repair during this time. Sermorelin has a promoting effect on sleep and can therefore make you tired if taken during the day.buy Sermorelin online..
5.How do you measure the effectiveness of Sermorelin?
Due to the pulsatile nature of both endogenous HGH and IGF-1, a single blood draw is not sufficient for accurate measurement. buy sermorelin acetate.Most physicians who prescribe Sermorelin and similar peptides measure effectiveness in patients through symptomology (the study of your symptoms-see benefits);physical appearance and measurements;and more frequent blood analysis.buy Sermorelin online.(where to buy sermorelin? www.biopepshop.com).
6.DOSAGE AND ADMINISTRATION for Sermorelin
A dosage of 0.2 – 0.3 mg once daily at bedtime by subcutaneous injection is recommended. It is also recommended that subcutaneous injection sites be periodically rotated.To prevent possible contamination, wipe the rubber vial stopper with an antiseptic solution before puncturing it with the needle. It is recommended that Sermorelin be administered using sterile, disposable syringes and needles. .(where to buy sermorelin? www.biopepshop.com). The syringes should be of small enough volume that the prescribed dose can be drawn from the vial with reasonable accuracy.buy Sermorelin online.To reconstitute Sermorelin, inject the diluent into the vial of Sermorelin aiming the liquid against the glass vial wall. buy sermorelin acetate.Swirl the vial with a GENTLE rotary motion until contents are dissolved completely. Do not administer Sermorelin if particles are visible in the reconstituted solution or if the reconstituted solution is cloudy.
7. SIDE EFFECTS for Sermorelin
A large proportion of patients develop anti- GRF antibodies at least once during treatment with Sermorelin. The significance of these antibodies is not clear and often a positive test at one growth assessment will become negative by the next assessment. The presence of antibodies does not appear to affect growth or appear to be related to a specific adverse reaction profile..(where to buy sermorelin?www.biopepshop.com) No generalized allergic reactions to Sermorelin have been reported.buy Sermorelin online.The most common treatment-related adverse event (occurring in about 1 patient in 6) is local injection reaction characterized by pain, swelling or redness. buy sermorelin acetate.Of 350 patients exposed to Sermorelin in clinical trials, three discontinued therapy due to injection reactions. Other treatment-related adverse events had individual occurrence rates of less than 1% and include: headache, flushing, dysphagia, dizziness, hyperactivity, somnolence and urticaria.When administered intravenously for diagnostic use, the following adverse reactions have been noted: flushing of the face, injection site pain, redness and/or swelling, nausea, headache, vomiting, dysgeusia, pallor and tightness in the chest.
8.How will I know its working?
After 4 years of observing patients taking Sermorelin, I have noticed that patients usually report improved sleep within the first few weeks of therapy. .(where to buy sermorelin?www.biopepshop.com). Of course this is only noticed in patients who have trouble sleeping in the first place,however most patients at least notice an increase in sleep quality.This is usually concurrent with increased energy levels and improved mood.buy Sermorelin online.After 3-6 months of therapy patients start reporting noticeable or significant body changes, such as increase in muscle tone and a leaner physique. buy sermorelin acetate.Over time patients will also notice a significant improvement in skin tone and health.
9.How long does Sermorelin take to work?
Just like most peptide hormones, Sermorelin usually has a “loading” period of 3-6 months before full effects are noticed.Once injected,both Sermorelin and rHGH are eliminated from then body very quickly and therefore need to be injected frequently.Its actions are dependent on a chain reaction of biological processes which result in elevated and sustained HGH and growth factors.buy Sermorelin online.It takes some time for levels to become optimal and initiate the benefits we are seeking to achieve.
10.Do I need to take Sermorelin forever to keep seeing results?
Actually, no. Sermorelin has an ongoing effect in which optimal HGH levels can be sustained long after the last injection.buy sermorelin acetate.Just like synthetic HGH, Sermorelin initially must be injected every day..(where to buy sermorelin? www.biopepshop.com). Unlike synthetic HGH,once optimal levels are sustained with Sermorelin injection frequencies can be decreased or stopped altogether.buy Sermorelin online.Once results are achieved,patients are then switched to a maintenance protocol eliminating the need for ongoing daily injections and reducing the total cost of therapy!
11.Storage for Sermorelin:Lyophilized SERMORELIN although stable at room temperature for 3 weeks,should be stored desiccated below -18°C.buy sermorelin acetate.buy Sermorelin online.Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C..
CAUTION:
This product is NOT intended to prevent, treat, or cure disease conditions or to affect the structure or function of the body. The sale of this product is restricted to research applications ONLY. This product is NOT for human consumption. This product can be harmful if ingested. Picture may differ from actual product.